Recombinant Human Sodium-glucose cotransporter 2(SLC5A2), partial

Recombinant Human Sodium-glucose cotransporter 2(SLC5A2), partial

CSB-EP021679HU1
Regular price
¥94,800 JPY
Sale price
¥94,800 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: Signal Transduction

Target / Protein: SLC5A2

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: P31639

AA Sequence: MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNA

Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-102aa

Protein length: Partial

MW: 15.5 kDa

Alternative Name(s): Low affinity sodium-glucose cotransporter Solute carrier family 5 member 2

Relevance: Sodium-dependent glucose transporter. Has a Na+ to glucose coupling ratio of 1:1. Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na+/glucose cotransporter arranged in series along kidney proximal tubules

Reference: "Thioglycosides as inhibitors of hSGLT1 and hSGLT2: potential therapeutic agents for the control of hyperglycemia in diabetes." Castaneda F., Burse A., Boland W., Kinne R.K. Int J Med Sci 4:131-139(2007)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share