Recombinant Human Putative small membrane protein NID67(NID67)

Recombinant Human Putative small membrane protein NID67(NID67)

CSB-CF887176HU
Regular price
¥165,300 JPY
Sale price
¥165,300 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Homo sapiens (Human)

Uniprot NO.:Q9BZL3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDAVSQVPMEVVLPKHILDIWVIVLIILATIVIMTSLLLCPATAVIIYRMRTHPILSGAV

Protein Names:Recommended name: Putative small membrane protein NID67 Alternative name(s): NGF-induced differentiation clone 67 protein

Gene Names:Name:NID67 Synonyms:C5orf62

Expression Region:1-60

Sequence Info:full length protein

Your list is ready to share