Recombinant Human Pulmonary surfactant-associated protein B(SFTPB)

Recombinant Human Pulmonary surfactant-associated protein B(SFTPB)

CSB-BP021173HU
Regular price
¥67,300 JPY
Sale price
¥67,300 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 20ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 25-35 working days

Research Topic: Cardiovascular

Uniprot ID: P07988

Gene Names: SFTPB

Organism: Homo sapiens (Human)

AA Sequence: FPIPLPYCWLCRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSM

Expression Region: 201-279aa

Sequence Info: Full Length of Mature Protein

Source: Baculovirus

Tag Info: N-terminal MBP-tagged

MW: 50.7 kDa

Alternative Name(s): 18 kDa pulmonary-surfactant protein 6 kDa protein Pulmonary surfactant-associated proteolipid SPL(Phe)

Relevance: Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.

Reference: "Use of human surfactant low molecular weight apoproteins in the reconstitution of surfactant biologic activity." Revak S.D., Merritt T.A., Degryse E., Stefani L., Courtney M., Hallman M., Cochrane C.G. J. Clin. Invest. 81:826-833(1988)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share