Recombinant Human Proteasome subunit beta type-10(PSMB10)

Recombinant Human Proteasome subunit beta type-10(PSMB10)

CSB-EP018877HU
Regular price
¥80,900 JPY
Sale price
¥80,900 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Immunology

Uniprot ID: P40306

Gene Names: PSMB10

Organism: Homo sapiens (Human)

AA Sequence: MLKPALEPRGGFSFENCQRNASLERVLPGLKVPHARKTGTTIAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTLFRYQGHVGASLIVGGVDLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAVTAGILGDLGSGGNVDACVITKTGAKLLRTLSSPTEPVKRSGRYHFVPGTTAVLTQTVKPLTLELVEETVQAMEVE

Expression Region: 1-273aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 51.6 kDa

Alternative Name(s): Low molecular mass protein 10 Macropain subunit MECl-1 Multicatalytic endopeptidase complex subunit MECl-1 Proteasome MECl-1 Proteasome subunit beta-2i

Relevance: The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides.

Reference: "A tight cluster of five unrelated human genes on chromosome 16q22.1." Larsen F., Solheim J., Kristensen T., Kolstoe A.-B., Prydz H. Hum. Mol. Genet. 2:1589-1595(1993)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share