Recombinant Human Lymphocyte antigen 6 complex locus protein G6d(LY6G6D)

Recombinant Human Lymphocyte antigen 6 complex locus protein G6d(LY6G6D)

CSB-EP013246HU
Regular price
¥106,400 JPY
Sale price
¥106,400 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Others

Target / Protein: LY6G6D

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: O95868

AA Sequence: NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS

Tag info: N-terminal 10xHis-B2M-tagged

Expression Region: 20-104aa

Protein length: Full Length of Mature Protein

MW: 25.5 kDa

Alternative Name(s): Megakaryocyte-enhanced gene transcript 1 protein C6orf23, G6D, MEGT1, NG25

Relevance:

Reference: "Transcriptional analysis of a novel cluster of LY-6 family members in the human and mouse major histocompatibility complex: five genes with many splice forms." Mallya M., Campbell R.D., Aguado B. Genomics 80:113-123(2002)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share