Recombinant Human HEAT repeat-containing protein 6(HEATR6),partial

Recombinant Human HEAT repeat-containing protein 6(HEATR6),partial

CSB-EP721403HU
Regular price
¥126,000 JPY
Sale price
¥126,000 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q6AI08

Gene Names: HEATR6

Organism: Homo sapiens (Human)

AA Sequence: KSEDTIDFLEFKYCVSLRTQICQALIHLLSLASASDLPCMKETLELSGNMVQSYILQFLKSGAEGDDTGAPHSPQERDQMVRMALKHMGSIQAPTGDTARRAIMGFLEEILAVCFDSSGSQGAL

Expression Region: 1052-1175aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW: 18.5 kDa

Alternative Name(s): Amplified in breast cancer protein 1 ABC1

Relevance: Amplification-dependent oncogene.

Reference: "Structural analysis of the 17q22-23 amplicon identifies several independent targets of amplification in breast cancer cell lines and tumors." Wu G.-J., Sinclair C., Hinson S., Ingle J.N., Roche P.C., Couch F.J. Cancer Res. 61:4951-4955(2001)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share