Recombinant Human Glutathione S-transferase A2(GSTA2)

Recombinant Human Glutathione S-transferase A2(GSTA2)

CSB-EP009971HU
Regular price
¥107,900 JPY
Sale price
¥107,900 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: P09210

Gene Names: GSTA2

Organism: Homo sapiens (Human)

AA Sequence: MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFTQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF

Expression Region: 1-222aa

Sequence Info: Full Length of BC002895

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 52.7 kDa

Alternative Name(s): GST HA subunit 2 GST class-alpha member 2 GST-gamma GSTA2-2 GTH2

Relevance: Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.

Reference: "The basic glutathione S-transferases from human livers are products of separate genes." Rhoads D.M., Zarlengo R.P., Tu C.-P.D. Biochem. Biophys. Res. Commun. 145:474-481(1987)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share