Recombinant Human Glucagon-like peptide 1 receptor(GLP1R), partial

Recombinant Human Glucagon-like peptide 1 receptor(GLP1R), partial

CSB-BP009514HU-GB
Regular price
¥69,200 JPY
Sale price
¥69,200 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 20ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 25-35 working days

Research Topic: Neuroscience

Uniprot ID: P43220

Gene Names: GLP1R

Organism: Homo sapiens (Human)

AA Sequence: RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEQLLFLY

Expression Region: 24-145aa

Sequence Info: Partial

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged

MW: 16.8 kDa

Alternative Name(s):

Relevance: This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.

Reference: "Cloning and functional expression of the human islet GLP-1 receptor. Demonstration that exendin-4 is an agonist and exendin-(9-39) an antagonist of the receptor." Thorens B., Porret A., Buehler L., Deng S., Morel P., Widmann C. Diabetes 42:1678-1682(1993)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share