Recombinant Human G antigen 5(GAGE5)

Recombinant Human G antigen 5(GAGE5)

CSB-EP009186HU
Regular price
¥83,000 JPY
Sale price
¥83,000 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cancer

Uniprot ID: Q13069

Gene Names: GAGE5

Organism: Homo sapiens (Human)

AA Sequence: MSWRGRSTYYWPRPRRYVQPPEVIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC

Expression Region: 1-117aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 39.9 kDa

Alternative Name(s): Cancer/testis antigen 4.5 ;CT4.5

Relevance:

Reference: A new family of genes coding for an antigen recognized by autologous cytolytic T lymphocytes on a human melanoma.van den Eynde B., Peeters O., de Backer O., Gaugler B., Lucas S., Boon T.J. Exp. Med. 182:689-698(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share