Recombinant Human Deoxyribonuclease gamma(DNASE1L3)

Recombinant Human Deoxyribonuclease gamma(DNASE1L3)

CSB-EP621686HU
Regular price
¥103,500 JPY
Sale price
¥103,500 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171228

Research areas: Cell Biology

Target / Protein: DNASE1L3

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: Q13609

AA Sequence: MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS

Tag info: N-terminal GST-tagged

Expression Region: 21-305aa

Protein length: Full Length of Mature Protein

MW: 60.4 kDa

Alternative Name(s): DNase I homolog protein DHP2 Deoxyribonuclease I-like 3 Short name: DNase I-like 3 Liver and spleen DNase Short name: LS-DNase Short name: LSD

Relevance: Has DNA hydrolytic activity. Does not bind to actin. Cleaves chromatin DNA to nucleosomal units.

Reference: "Identification, localization, and expression of two novel human genes similar to deoxyribonuclease I."Rodriguez A.M., Rodin D., Nomura H., Morton C.C., Weremowicz S., Schneider M.C.Genomics 42:507-513(1997)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share