Recombinant Escherichia coli  Putative ferric transport system permease protein fbpB(fbpB)

Recombinant Escherichia coli Putative ferric transport system permease protein fbpB(fbpB)

CSB-CF303446ENV
Regular price
¥172,100 JPY
Sale price
¥172,100 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli (strain K12)

Uniprot NO.:P75681

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GQIDKSLDEASLSLRAGSLRTITHILLPLLRPAILSALIYSFVRAITTVSAIVFLVTPDT RVATAYILNRVEDGEYGVAIAYGSILIVVMLAIIFIFDWLIGESRTSRSKAKNQA

Protein Names:Recommended name: Putative ferric transport system permease protein fbpB

Gene Names:Name:fbpB Synonyms:afuB Ordered Locus Names:b0263, JW0255

Expression Region:1-115

Sequence Info:full length protein

Your list is ready to share