Gene Bio Systems
Recombinant Enterobacteria phage PRD1 Protein P35(XXXV)
Recombinant Enterobacteria phage PRD1 Protein P35(XXXV)
SKU:CSB-CF659687EDO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Enterobacteria phage PRD1 (Bacteriophage PRD1)
Uniprot NO.:Q3T4L9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MMENDEWWKYLIFPLVATLGGIVNYSKRALAMKRFSKLEFAVEAVSAAFVGLMVTLGGAA MDLSPHWLGMAAGMSGWMGADFVKAVFSQFVQSKIAPINQPGPIDSDNDKPGRTFND
Protein Names:Recommended name: Protein P35 Alternative name(s): Holin
Gene Names:Name:XXXV
Expression Region:1-117
Sequence Info:full length protein
