Recombinant Emericella nidulans  Cytochrome c oxidase assembly protein cox16, mitochondrial(cox16)

Recombinant Emericella nidulans Cytochrome c oxidase assembly protein cox16, mitochondrial(cox16)

CSB-CF704645EKF
Regular price
¥168,200 JPY
Sale price
¥168,200 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans)

Uniprot NO.:Q5AXJ9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:TTASSTLGEKLGEAYRARLPRHPFLLFGLPFIMVIVAGSFVLTPATALRYERYDRKVKQL SQEEAMDLGLKGPDGEEGIKRNPRRRIIGDDREEYYRLMAKDLDSWEQKRVQRFKGEPDG RL

Protein Names:Recommended name: Cytochrome c oxidase assembly protein cox16, mitochondrial

Gene Names:Name:cox16 ORF Names:AN10871

Expression Region:13-134

Sequence Info:full length protein

Your list is ready to share