Recombinant Drosophila pseudoobscura pseudoobscura  UPF0466 protein GA14609, mitochondrial(GA14609)

Recombinant Drosophila pseudoobscura pseudoobscura UPF0466 protein GA14609, mitochondrial(GA14609)

CSB-CF641821DME
Regular price
¥165,500 JPY
Sale price
¥165,500 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Drosophila pseudoobscura pseudoobscura (Fruit fly)

Uniprot NO.:Q290M9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SGVYFRSGALRPKPDEMPFGLFAIFCAVIPGLFIGATISKNVANFLEENDLFVPSDDDDD ED

Protein Names:Recommended name: UPF0466 protein GA14609, mitochondrial

Gene Names:ORF Names:GA14609

Expression Region:35-96

Sequence Info:full length protein

Your list is ready to share