Recombinant Dog Interleukin-4(IL4)

Recombinant Dog Interleukin-4(IL4)

CSB-EP011659DO
Regular price
¥122,100 JPY
Sale price
¥122,100 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: O77762

Gene Names: L4

Organism: Canis lupus familiaris (Dog) (Canis familiaris)

AA Sequence: HNFNITIKEIIKMLNILTARNDSCMELTVKDVFTAPKNTSDKEIFCRAATVLRQIYTHNCSNRYLRGLYRNLSSMANKTCSMNEIKKSTLKDFLERLKVIMQKKYYRH

Expression Region: 25-132aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 16.8 kDa

Alternative Name(s): B-cell stimulatory factor 1 ;BSF-1Lymphocyte stimulatory factor 1

Relevance: Participates in at least several B-cell activation processes as well as of other cell types. It is a costimulator of DNA-synthesis. It induces the expression of class II MHC molecules on resting B-cells. It enhances both secretion and cell surface expression of IgE and IgG1. It also regulates the expression of the low affinity Fc receptor for IgE (CD23) on both lymphocytes and monocytes .

Reference: Molecular cloning, expression and characterization of the Canis familiaris interleukin-4.Wondimu A., Veit M., Kohn B., Kaul S., Hoffmann A., Brunnberg L., Schmidt M.F.Cytokine 16:88-92(2001)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share