Recombinant Bovine T-cell surface glycoprotein CD8 alpha chain(CD8A),partial

Recombinant Bovine T-cell surface glycoprotein CD8 alpha chain(CD8A),partial

CSB-EP004966BO
Regular price
¥124,700 JPY
Sale price
¥124,700 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P31783

Gene Names: CD8A

Organism: Bos taurus (Bovine)

AA Sequence: LSFRMSPTQKETRLGEKVELQCELLQSGMATGCSWLRHIPGDDPRPTFLMYLSAQRVKLAEGLDPRHISGAKVSGTKFQLTLSSFLQEDQGYYFCSVVSNSILYFSNFVPVFLPAKPATTPAMRPSSAAPTSAPQTRSVSPRSEVCRTSAGSAVDTSRLDFACN

Expression Region: 26-189aa

Sequence Info: Extracellular Domain

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 33.9 kDa

Alternative Name(s): CD8a

Relevance: Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing. CD8 alpha chains binds to class I MHC molecules alpha-3 domains.

Reference: Molecular cloning, reconstruction and expression of the gene encoding the alpha-chain of the bovine CD8 -- definition of three peptide regions conserved across species.Lalor P., Bucci C., Fornaro M., Rattazzi M.C., Nakauchi H., Herzenberg L.A., Alberti S.Immunology 76:95-102(1992)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share