Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus subtilis Uncharacterized protein yjdJ(yjdJ)

Recombinant Bacillus subtilis Uncharacterized protein yjdJ(yjdJ)

SKU:CSB-CF520009BRJ

Regular price ¥248,500 JPY
Regular price Sale price ¥248,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:O31651

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:YQGSELVSDRFDWNYTAKLSKLLNGIDAVSSPKQISQLDFFIYSAKHYPVMSALMIISFL YVLAALFLLIYSVKCNKQEIHLDC

Protein Names:Recommended name: Uncharacterized protein yjdJ

Gene Names:Name:yjdJ Ordered Locus Names:BSU12070

Expression Region:26-109

Sequence Info:full length protein

View full details