Recombinant Bacillus subtilis  Uncharacterized membrane protein yndK(yndK)

Recombinant Bacillus subtilis Uncharacterized membrane protein yndK(yndK)

CSB-CF521773BRJ
Regular price
¥172,800 JPY
Sale price
¥172,800 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:O31814

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNCFKILHRIKTGKEGFMVFYISLFLILWLAAGFAVGMKQVYVDQLFDKAVIERLEKEAN DHGHADRMIKQRVLYIAAVTVSGFISVYYEMKTIPQRRNIRKIEKNIMKLNQAKKRRMKR K

Protein Names:Recommended name: Uncharacterized membrane protein yndK

Gene Names:Name:yndK Ordered Locus Names:BSU17810

Expression Region:1-121

Sequence Info:full length protein

Your list is ready to share