Recombinant Arabidopsis thaliana  Defender against cell death 2(DAD2)

Recombinant Arabidopsis thaliana Defender against cell death 2(DAD2)

CSB-CF517779DOA
Regular price
¥172,000 JPY
Sale price
¥172,000 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:O22622

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVKSTSKDAQDLFHSLHSAYTATPTNLKIIDLYVCFAVFTALIQVAYMALVGSFPFNSFL SGVLSCIGTAVLAVCLRIQVNKENKEFKDLAPERAFADFVLCNLVLHLVIINFLG

Protein Names:Recommended name: Defender against cell death 2 Short name= AtDAD2 Short name= DAD-2

Gene Names:Name:DAD2 Ordered Locus Names:At2g35520 ORF Names:T32F12.10

Expression Region:1-115

Sequence Info:full length protein

Your list is ready to share