Recombinant Agrostis stolonifera  Photosystem II reaction center protein Z(psbZ)

Recombinant Agrostis stolonifera Photosystem II reaction center protein Z(psbZ)

CSB-CF374004AUM
Regular price
¥163,600 JPY
Sale price
¥163,600 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Agrostis stolonifera (Creeping bentgrass)

Uniprot NO.:A1E9Z5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTIAFQLAVFALIATSSVLVISVPLVFASPDGWSNNKNVVFSGTSLWIGLVFLVAILNSL IS

Protein Names:Recommended name: Photosystem II reaction center protein Z Short name= PSII-Z

Gene Names:Name:psbZ

Expression Region:1-62

Sequence Info:full length protein

Your list is ready to share