
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Zea mays (Maize)
Uniprot NO.:Q41773
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:VPVVMAGVLGIYGLIIAVIISTGINPKAKPYYLFDGYAHLSSGLACGLAGLAAGMAIGIV GDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSRAGQSRAD
Protein Names:Recommended name: V-type proton ATPase 16 kDa proteolipid subunit Short name= V-ATPase 16 kDa proteolipid subunit Alternative name(s): Vacuolar proton pump 16 kDa proteolipid subunit
Gene Names:
Expression Region:1-109
Sequence Info:full length protein
You may also like
-
Recombinant V-type proton ATPase 16 kDa proteolipid subunit(VMA3)
- Regular price
- £1,117.00 GBP
- Sale price
- £1,117.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant V-type proton ATPase 16 kDa proteolipid subunit(VMA3)
- Regular price
- £1,116.00 GBP
- Sale price
- £1,116.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse V-type proton ATPase 16 kDa proteolipid subunit(Atp6v0c)
- Regular price
- £1,100.00 GBP
- Sale price
- £1,100.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Sheep V-type proton ATPase 16 kDa proteolipid subunit(ATP6V0C)
- Regular price
- £1,100.00 GBP
- Sale price
- £1,100.00 GBP
- Regular price
-
- Unit price
- per
Sold out