Recombinant Xanthobacter autotrophicus  ATP synthase subunit b 2(atpF2)

Recombinant Xanthobacter autotrophicus ATP synthase subunit b 2(atpF2)

CSB-CF417050XAV
Regular price
£923.00 GBP
Sale price
£923.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

Uniprot NO.:A7IGS8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVAQAAPPAGTAGQGTHEAASAAHGAAAAHGAAEEGHGKKSHFPPFDATTFASQLLWLVL SFGLLYLLMSRVALPRIGRILEERHDRIADDLEEAAKHKAESEAAQASYEKALAEARAKA NAIAGETRNRLAADSEANRKSLEAGLAVKLATAEQSIASTKTEALTHVRGIAVDATHAIV STLIGSSPAQSDVEKAVDVALVKKDAA

Protein Names:Recommended name: ATP synthase subunit b 2 Alternative name(s): ATP synthase F(0) sector subunit b 2 ATPase subunit I 2 F-type ATPase subunit b 2 Short name= F-ATPase subunit b 2

Gene Names:Name:atpF2 Ordered Locus Names:Xaut_1977

Expression Region:1-207

Sequence Info:full length protein

Your list is ready to share