
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: O02380
Gene Names: N/A
Organism: Tyrophagus putrescentiae (Mold mite) (Acarus putrescentiae)
AA Sequence: GQVKFTDCGKKEIASVAVDGCEGDLCVIHKSKPVHVIAEFTANQDTCKIEVKVTGQLNGLEVPIPGIETDGCKVLKCPLKKGTKYTMNYSVNVPSVVPNIKTVVKLLATGEHGVLACGAVNTDVKP
Expression Region: 16-141aa
Sequence Info: Full Length of Mature Protein
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 17.3 kDa
Alternative Name(s): Allergen: Typ p 2
Relevance:
Reference: "Cloning and characterisation of a group II allergen from the dust mite Tyrophagus putrescentiae." Eriksson T.L.J., Johansson E., Whitley P., Schmidt M., Elsayed S., van Hage-Hamsten M. Eur. J. Biochem. 251:443-447(1998)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Tyrophagus putrescentiae Mite group 2 allergen Tyr p 2
- Regular price
- £543.00 GBP
- Sale price
- £543.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Dermatophagoides pteronyssinus Mite group 2 allergen Der p 2(DERP2)
- Regular price
- £700.00 GBP
- Sale price
- £700.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Dermatophagoides pteronyssinus Mite group 2 allergen Der p 2(DERP2)
- Regular price
- £638.00 GBP
- Sale price
- £638.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Dermatophagoides farinae Mite group 2 allergen Der f 2(DERF2)
- Regular price
- £700.00 GBP
- Sale price
- £700.00 GBP
- Regular price
-
- Unit price
- per
Sold out