Recombinant Thermus thermophilus  NADH-quinone oxidoreductase subunit 7(nqo7)

Recombinant Thermus thermophilus NADH-quinone oxidoreductase subunit 7(nqo7)

CSB-CF687923TNT
Regular price
£869.00 GBP
Sale price
£869.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)

Uniprot NO.:Q56217

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAPIQEYVGTLIYVGVALFIGVAALLVGALLGPKKPGRAKLMPYESGNDPAGEVKRFPVH FYVVAMLFILFDVEVAFLWPYAVSAGGLGLYGFLGVLAFTLLLFVGFLYEWWKGVMRWH

Protein Names:Recommended name: NADH-quinone oxidoreductase subunit 7 EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I chain 7 NDH-1 subunit 7

Gene Names:Name:nqo7 Ordered Locus Names:TTHA0084

Expression Region:1-119

Sequence Info:full length protein

Your list is ready to share