Recombinant  Succinate dehydrogenase hydrophobic membrane anchor subunit(sdhD)

Recombinant Succinate dehydrogenase hydrophobic membrane anchor subunit(sdhD)

CSB-CF841277EOD
Regular price
£865.00 GBP
Sale price
£865.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli O157:H7

Uniprot NO.:Q8X9A9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFCASAFTKVF TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV

Protein Names:Recommended name: Succinate dehydrogenase hydrophobic membrane anchor subunit

Gene Names:Name:sdhD Ordered Locus Names:Z0876, ECs0747

Expression Region:1-115

Sequence Info:full length protein

Your list is ready to share