Recombinant Staphylococcus aureus  Na(+)-H(+) antiporter subunit G1

Recombinant Staphylococcus aureus Na(+)-H(+) antiporter subunit G1

CSB-CF412417FLG
Regular price
£873.00 GBP
Sale price
£873.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Staphylococcus aureus (strain Newman)

Uniprot NO.:A6QFF6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYF IATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL

Protein Names:Recommended name: Na(+)/H(+) antiporter subunit G1 Alternative name(s): Mnh complex subunit G1

Gene Names:Name:mnhG1 Ordered Locus Names:NWMN_0816

Expression Region:1-118

Sequence Info:full length protein

Your list is ready to share