Recombinant Sheep Tumor necrosis factor(TNF),Partial

Recombinant Sheep Tumor necrosis factor(TNF),Partial

CSB-EP023955SH
Regular price
£637.00 GBP
Sale price
£637.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P23383

Gene Names: TNF

Organism: Ovis aries (Sheep)

AA Sequence: LRSSSQASNNKPVAHVVANISAPGQLRWGDSYANALMANGVELKDNQLVVPTDGLYLIYSQVLFRGHGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETLEGAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPEYLDYAESGQVYFGIIAL

Expression Region: 78-234aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 44.2 kDa

Alternative Name(s): Cachectin;TNF-alphaTumor necrosis factor ligand superfamily member 2 ;TNF-a

Relevance: Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.

Reference: Molecular cloning, expression and characterization of ovine TNF alpha.Andrews A.E., Nash A.D., Barcham G.J., Brandon M.R.Immunol. Cell Biol. 69:273-283(1991)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share