Recombinant Sheep Interleukin-12 subunit beta(IL12B)

Recombinant Sheep Interleukin-12 subunit beta(IL12B)

CSB-EP011587SH
Regular price
£634.00 GBP
Sale price
£634.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P68220

Gene Names: IL12B

Organism: Ovis aries (Sheep)

AA Sequence: IWELEKNVYVVELDWYPNAPGETVVLTCDTPEEDGITWTSDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSRSLLLLHKKEDGIWSTDILKDQKEPKAKSFLKCEAKDYSGHFTCSWLTAISTNLKFSVKSSRGSSDPRGVTCGAASLSAEKVSMDHREYNKYTVECQEGSACPAAEESLPIEVVMEAVHKLKYENYTSSFFIRDIIKPDPPKNLQLRPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKNKREKKLFTDQTSAKVTCHKDANIRVQARDRYYSSFWSEWASVSCS

Expression Region: 23-327aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 38.5 kDa

Alternative Name(s): Cytotoxic lymphocyte maturation factor 40KDA subunit ;CLMF p40IL-12 subunit p40

Relevance: Cytokine that can act as a growth factor for activated T and NK cells, enhance the lytic activity of NK/lymphokine-activated killer cells, and stimulate the production of IFN-gamma by resting PBMC.Associates with IL23A to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates mory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis .

Reference: Ovine interleukin 12 has biological activity on ovine and human activated peripheral blood mononuclear cells.Swinburne S.J., Russ G.R., Krishnan R.Cytokine 12:1546-1552(2000)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share