Recombinant Schizosaccharomyces pombe  Putative uncharacterized protein C794.16 (SPCC794.16)

Recombinant Schizosaccharomyces pombe Putative uncharacterized protein C794.16 (SPCC794.16)

CSB-CF518823SXV
Regular price
£871.00 GBP
Sale price
£871.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Uniprot NO.:G2TRT9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQLNRSNKNLARRNVPYSKVFYLHSLKTSVRTKRINLKNIHSYLNAENCNDKKNFFFLSK TISFTNFVASNHLNKKIPIRLDKLNGLTLLTKKNFFFFFFFFTTITYSQSLRYTLLLIVF LFF

Protein Names:Recommended name: Putative uncharacterized protein C794.16

Gene Names:ORF Names:SPCC794.16

Expression Region:1-123

Sequence Info:full length protein

Your list is ready to share