
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Uniprot NO.:P38752
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MRKESFLTFYFSNHLYLCPAIIRLSSVCTLARTDYYLPSNIAVTYDIQISSLGFTYRIDF FLALFSDPARPFLTEINRKIGQYACVIREREQAGEYSFHYSLCININVYILHIHIYIDRY IYAYINAQVQ
Protein Names:Recommended name: Putative uncharacterized protein YHL005C
Gene Names:Ordered Locus Names:YHL005C
Expression Region:1-130
Sequence Info:full length protein
You may also like
-
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YLL059C(YLL059C)
- Regular price
- £901.00 GBP
- Sale price
- £901.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YCL021W-A(YCL021W-A)
- Regular price
- £874.00 GBP
- Sale price
- £874.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YLL053C (YLL053C)
- Regular price
- £891.00 GBP
- Sale price
- £891.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YFL015C (YFL015C)
- Regular price
- £899.00 GBP
- Sale price
- £899.00 GBP
- Regular price
-
- Unit price
- per
Sold out