Gene Bio Systems
Recombinant Rickettsia conorii Ubiquinol-cytochrome c reductase iron-sulfur subunit(petA)
Recombinant Rickettsia conorii Ubiquinol-cytochrome c reductase iron-sulfur subunit(petA)
SKU:CSB-CF821807RMS
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Uniprot NO.:Q92IR2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSDTEDNKNKQTTRRDFMVLTASSVAAIGAVCTLWPLVDSLNPSADVLALSSIEVDLSNI AVGQTVTVKWQGKPVFITNRTPDKIAEARAVKMSELIDPEADQARVKAGHDNWLVTIGIC THLGCVPLANQGEYDGWFCPCHGSQYDSSGRVRRGPAPLNLAVPPYTFISDKKIRIG
Protein Names:Recommended name: Ubiquinol-cytochrome c reductase iron-sulfur subunit EC= 1.10.2.2 Alternative name(s): Rieske iron-sulfur protein Short name= RISP
Gene Names:Name:petA Ordered Locus Names:RC0358
Expression Region:1-177
Sequence Info:full length protein
