Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rickettsia conorii Ubiquinol-cytochrome c reductase iron-sulfur subunit(petA)

Recombinant Rickettsia conorii Ubiquinol-cytochrome c reductase iron-sulfur subunit(petA)

SKU:CSB-CF821807RMS

Regular price £1,275.00 GBP
Regular price Sale price £1,275.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rickettsia conorii (strain ATCC VR-613 / Malish 7)

Uniprot NO.:Q92IR2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSDTEDNKNKQTTRRDFMVLTASSVAAIGAVCTLWPLVDSLNPSADVLALSSIEVDLSNI AVGQTVTVKWQGKPVFITNRTPDKIAEARAVKMSELIDPEADQARVKAGHDNWLVTIGIC THLGCVPLANQGEYDGWFCPCHGSQYDSSGRVRRGPAPLNLAVPPYTFISDKKIRIG

Protein Names:Recommended name: Ubiquinol-cytochrome c reductase iron-sulfur subunit EC= 1.10.2.2 Alternative name(s): Rieske iron-sulfur protein Short name= RISP

Gene Names:Name:petA Ordered Locus Names:RC0358

Expression Region:1-177

Sequence Info:full length protein

View full details