Recombinant Rhodoferax ferrireducens  Protein CrcB homolog(crcB)

Recombinant Rhodoferax ferrireducens Protein CrcB homolog(crcB)

CSB-CF630454RAAJ
Regular price
£869.00 GBP
Sale price
£869.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rhodoferax ferrireducens (strain DSM 15236 / ATCC BAA-621 / T118)

Uniprot NO.:Q21Y62

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRLMISVLAICIGASLGALARWRLGLWLNPGAVLPLGTLAANLIGGYLIGICVAVFQALP NLDPVWRLALITGFLGGLTTFSSFSAEVVGMLGQQRYALGFGTAGLHLFGSLLLTLAGIK TATFLIAFNT

Protein Names:Recommended name: Protein CrcB homolog

Gene Names:Name:crcB Ordered Locus Names:Rfer_1559

Expression Region:1-130

Sequence Info:full length protein

Your list is ready to share