Skip to product information
1 of 1

Gene Bio Systems

Recombinant Psychromonas ingrahamii Lipoprotein signal peptidase(lspA)

Recombinant Psychromonas ingrahamii Lipoprotein signal peptidase(lspA)

SKU:CSB-CF377300PZS

Regular price £1,268.00 GBP
Regular price Sale price £1,268.00 GBP
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Psychromonas ingrahamii (strain 37)

Uniprot NO.:A1SZP2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAEIIEKSGLRWLWLAAIMLALDQVTKYWTIQSLDLYESYEIFSFFSFTYARNYGAAFSF LGDAGGWQRYLFTAIAIVVSSYLVYLLKKNASTDRWINCAYALILSGALGNVVDRMMFGY VIDFLDFDLGFYRWPTFNIADSAIFTGAVIMIFESFFAKQAKPIKQPKGNKNV

Protein Names:Recommended name: Lipoprotein signal peptidase EC= 3.4.23.36 Alternative name(s): Prolipoprotein signal peptidase Signal peptidase II Short name= SPase II

Gene Names:Name:lspA Ordered Locus Names:Ping_3270

Expression Region:1-173

Sequence Info:full length protein

View full details