Gene Bio Systems
Recombinant Pseudomonas syringae pv. phaseolicola Disulfide bond formation protein B 2(dsbB2)
Recombinant Pseudomonas syringae pv. phaseolicola Disulfide bond formation protein B 2(dsbB2)
SKU:CSB-CF674239PAAT
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6)
Uniprot NO.:Q48QE1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MYLARTRFLFFLASLACASIIGTAFYLQQTFGLDPCFLCLIQRAAIIACGVLALCAACHA PGPTGMRRYSLGFLLIALTGLVTAGAQVWLQTASADQLIPFITKLEHLLSLLSLDMCIDR LRSDAMFCAEITWTLFGISLPEWSLLAFTGLALLPLYPLFSEFSHWLATKDRARY
Protein Names:Recommended name: Disulfide bond formation protein B 2 Alternative name(s): Disulfide oxidoreductase 2
Gene Names:Name:dsbB2 Ordered Locus Names:PSPPH_0063
Expression Region:1-175
Sequence Info:full length protein
