Recombinant Pig PDZK1-interacting protein 1(PDZK1IP1)

Recombinant Pig PDZK1-interacting protein 1(PDZK1IP1)

CSB-CF764258PI
Regular price
£870.00 GBP
Sale price
£870.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Sus scrofa (Pig)

Uniprot NO.:Q6ITQ4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSALSLVILGLLMAVPPASCQQGLGNLQPWMQGLIAVAVFLVLVAIAFAINHFWCQEERE PMNMVMTTGNKADGILIGTEGKYSSMAASFRSNEHENAYENTSEEEGRVHSTPM

Protein Names:Recommended name: PDZK1-interacting protein 1 Alternative name(s): 17 kDa membrane-associated protein

Gene Names:Name:PDZK1IP1 Synonyms:MAP17

Expression Region:1-114

Sequence Info:full length protein

Your list is ready to share