Recombinant Pasteurella multocida Uncharacterized protein PM1437(PM1437)

CSB-CF875042ESG

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pasteurella multocida (strain Pm70)

Uniprot NO.:Q9CL11

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MERENKPKGFSGFSWGIALFCLPILLWPLALTISPNLLKNPRLSETETTLMSVFLWAYPF GLALIARLAYRLNQHKPPFARGLLGLSAVAFYGMLFYVAGGFH

Protein Names:Recommended name: Uncharacterized protein PM1437

Gene Names:Ordered Locus Names:PM1437

Expression Region:1-103

Sequence Info:full length protein