Recombinant Oncorhynchus keta L-rhamnose-binding lectin CSL3

Recombinant Oncorhynchus keta L-rhamnose-binding lectin CSL3

CSB-YP309229OBG
Regular price
£615.00 GBP
Sale price
£615.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic:

Uniprot ID: P86179

Gene Names: N/A

Organism: Oncorhynchus keta (Chum salmon) (Salmo keta)

AA Sequence: AISITCEGSDALLQCDGAKIHIKRANYGRRQHDVCSIGRPDNQLTDTNCLSQSSTSKMAERCGGKSECIVPASNFVFGDPCVGTYKYLDTKYSCVQQQETISSIICEGSDSQLLCDRGEIRIQRANYGRRQHDVCSIGRPHQQLKNTNCLSQSTTSKMAERCDGKRQCIVSVSNSVFGDPCVGTYKYLDVAYTCD

Expression Region: 1-195aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 10xHis-tagged

MW: 24 kDa

Alternative Name(s):

Relevance: L-rhamnose binding lectin. Has hemagglutinating activity towards rabbit erythrocytes, human type A erythrocytes, human type B erythrocytes, human type O erythrocytes and sheep erythrocytes. Hemagglutinating activity is inhibited by smooth-type lipopolysaccharide (LPS) from S.flexneri 1A, A.salmonicida and E.coli K12, but not by rough-type LPS from S.flexneri, E.coli K12 and E.coli EH100. Agglutinates E.coli K12 and B.subtilis.

Reference: "Isolation and characterization of L-rhamnose-binding lectins from chum salmon (Oncorhynchus keta) eggs." Shiina N., Tateno H., Ogawa T., Muramoto K., Saneyoshi M., Kamiya H. Fish. Sci. 68:1352-1366(2002)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share