
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831)
Uniprot NO.:Q8CUT6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MWKEFKEFAFKGNIIDLAVAVVIGGAFGAIVTSFVENIITPLMGVIVGGVDFTTLKVTVG EAEILYGNFIQSFVDFIIIAFSIFLAIKFLVKFKRQKEEEEVEAVVEELSKQEELLTEIR DLLKEQSNKN
Protein Names:Recommended name: Large-conductance mechanosensitive channel
Gene Names:Name:mscL Ordered Locus Names:OB1021
Expression Region:1-130
Sequence Info:full length protein
You may also like
-
Recombinant Methylobacillus flagellatus Large-conductance mechanosensitive channel(mscL)
- Regular price
- £882.00 GBP
- Sale price
- £882.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bacillus weihenstephanensis Large-conductance mechanosensitive channel(mscL)
- Regular price
- £878.00 GBP
- Sale price
- £878.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Acinetobacter sp. Large-conductance mechanosensitive channel(mscL)
- Regular price
- £887.00 GBP
- Sale price
- £887.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Large-conductance mechanosensitive channel(mscL)
- Regular price
- £881.00 GBP
- Sale price
- £881.00 GBP
- Regular price
-
- Unit price
- per
Sold out