Gene Bio Systems
Recombinant Nitrosomonas eutropha Disulfide bond formation protein B(dsbB)
Recombinant Nitrosomonas eutropha Disulfide bond formation protein B(dsbB)
SKU:CSB-CF601177NAAD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Nitrosomonas eutropha (strain C91)
Uniprot NO.:Q0AFX4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MRIIFLLIFLACAGLIGYALYLQLMDGLLPCPLCIFQRIAYWLIGITALFTFIHNPQSLG QHIYYGLIILFSLAGAIVAGRQAWLIRFPEAFECGISPEEAFLNGLPLAQWWPNMFEANG DCNDGTWQFLSLTLPDWSLLIFAAFGIIAGLLWHKKYNSINQ
Protein Names:Recommended name: Disulfide bond formation protein B Alternative name(s): Disulfide oxidoreductase
Gene Names:Name:dsbB Ordered Locus Names:Neut_1513
Expression Region:1-162
Sequence Info:full length protein
