Recombinant Neisseria meningitidis serogroup B - serotype 15 Major outer membrane protein P.IB(porB)

Recombinant Neisseria meningitidis serogroup B - serotype 15 Major outer membrane protein P.IB(porB)

CSB-EP518750NGH
Regular price
£636.00 GBP
Sale price
£636.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Signal Transduction

Target / Protein: porB

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Neisseria meningitidis serogroup B / serotype 15 (strain H44/76)

Delivery time: 3-7 business days

Uniprot ID: E6MZM0 

AA Sequence: DVTLYGTIKAGVETSRSVFHQNGQVTEVTTATGIVDLGSKIGFKGQEDLGNGLKAIWQVEQKASIAGTDSGWGNRQSFIGLKGGFGKLRVGRLNSVLKDTGDINPWDSKSDYLGVNKIAEPEARLISVRYDSPEFAGLSGSVQYALNDNAGRHNSESYHAGFNYKNGGFFVQYGGAYKRHHQVQEGLNIEKYQIHRLVSGYDNDALYASVAVQQQDAKLTDASNSHNSQTEVAATLAYRFGNVTPRVSYAHGFKGLVDDADIGNEYDQVVVGAEYDFSKRTSALVSAGWLQEGKGENKFVATAGGVGLRHKF

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 20-331aa

Protein length: Full Length of Mature Protein

MW: 49.8 kDa

Alternative Name(s): Class 3 protein Porin

Relevance: Serves as a slightly cation selective porin.

Reference: "Neisseria meningitidis is structured in clades associated with restriction modification systems that modulate homologous recombination." Budroni S., Siena E., Hotopp J.C., Seib K.L., Serruto D., Nofroni C., Comanducci M., Riley D.R., Daugherty S.C., Angiuoli S.V., Covacci A., Pizza M., Rappuoli R., Moxon E.R., Tettelin H., Medini D.Proc. Natl. Acad. Sci. U.S.A. 108:4494-4499(2011)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share