Recombinant Mouse Transmembrane protein 141(Tmem141)

Recombinant Mouse Transmembrane protein 141(Tmem141)

CSB-CF023711MO
Regular price
£861.00 GBP
Sale price
£861.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mus musculus (Mouse)

Uniprot NO.:A2AJB2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVNLGLSRVDDAVAARHPGLEEFAACQSHAFMKGVFTFVTGTGATFGLLMFIKRKFPYPV QWSFLVSAIAGSVASYRVTSMECQKCSNLWLFLETGQLPKDISTDPHD

Protein Names:Recommended name: Transmembrane protein 141

Gene Names:Name:Tmem141 Synonyms:D2Ertd217e

Expression Region:1-108

Sequence Info:Full length protein

Your list is ready to share