Recombinant Mouse Serine-threonine-protein kinase VRK1(Vrk1)

Recombinant Mouse Serine-threonine-protein kinase VRK1(Vrk1)

CSB-YP768902MOb1
Regular price
£538.00 GBP
Sale price
£538.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Cell Biology

Uniprot ID: Q80X41

Gene Names: Vrk1

Organism: Mus musculus (Mouse)

AA Sequence: MPRVKAAQAGRPGPAKRRLAEQFAAGEVLTDMSRKEWKLGLPIGQGGFGCIYLADTNSSKPVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTHKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLLLSHKNPDQVYLVDYGLAYRYCPDGVHKEYKEDPKRCHDGTLEFTSIDAHKGVAPSRRGDLEILGYCMIQWLSGCLPWEDNLKDPNYVRDSKIRYRDNVAALMEKCFPEKNKPGEIAKYMESVKLLEYTEKPLYQNLRDILLQGLKAIGSKDDGKLDFSAVENGSVKTRPASKKRKKEAEESAVCAVEDMECSDTQVQEAAQTRSVESQGAIHGSMSQPAAGCSSSDSSRRQQHLGLEQDMLRLDRRGSRTRKKAQK

Expression Region: 1-140aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW: 53.7 kDa

Alternative Name(s): Serine/threonine-protein kinase 51PK Vaccinia-related kinase 1

Relevance: Serine/threonine kinase involved in Golgi disassembly during the cell cycle: following phosphorylation by PLK3 during mitosis, required to induce Golgi fragmentation. Acts by mediating phosphorylation of downstream target protein. Phosphorylates 'Thr-18' of p53/TP53 and may thereby prevent the interaction between p53/TP53 and MDM2. Phosphorylates casein and histone H3. Phosphorylates BANF1: disrupts its ability to bind DNA, reduces its binding to LEM domain-containing proteins and causes its relocalization from the nucleus to the cytoplasm. Phosphorylates ATF2 which activates its transcriptional activity

Reference: "Expression of the VRK (vaccinia-related kinase) gene family of p53 regulators in murine hematopoietic development." Vega F.M., Gonzalo P., Gaspar M.L., Lazo P.A. FEBS Lett. 544:176-180(2003)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share