Recombinant Mouse Putative phospholipase B-like 2(Plbd2)

Recombinant Mouse Putative phospholipase B-like 2(Plbd2)

CSB-EP663623MO
Regular price
£538.00 GBP
Sale price
£538.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: others

Target / Protein: Plbd2

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Mus musculus (Mouse)

Delivery time: 3-7 business days

Uniprot ID: Q3TCN2

AA Sequence: LPTLGPGWQRQNPDPPVSRTRSLLLDAASGQLRLEDGFHPDAVAWANLTNAIRETGWAYLDLSTNGRYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKNFLEANLEWMQREMELNPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFTIKPLGFLLLQISGDLEDLEPALNKTNTKPSLGSGSCSALIKLLPGGHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEYPLVAGNNLVFSSYPGTIFSGDDFYILGSGLVTLETTIGNKNPALWKYVQPQGCVLEWIRNVVANRLALDGATWADVFKRFNSGTYNNQWMIVDYKAFLPNGPSPGSRVLTILEQIPGMVVVADKTAELYKTTYWASYNIPYFETVFNASGLQALVAQYGDWFSYTKNPRAKIFQRDQSLVEDMDAMVRLMRYNDFLHDPLSLCEACNPKPNAENAISARSDLNPANGSYPFQALHQRAHGGIDVKVTSFTLAKYMSMLAASGPTWDQCPPFQWSKSPFHSMLHMGQPDLWMFSPIRVPWD

Tag info: N-terminal 6xHis-tagged

Expression Region: 47-594aa

Protein length: Full Length of Mature Protein

MW: 65.9 kDa

Alternative Name(s): 66.3 kDa protein 76 kDa protein

Relevance: Putative phospholipase.

Reference: "Biochemical characterization and lysosomal localization of the mannose-6-phosphate protein p76 (hypothetical protein LOC196463)." Jensen A.G., Chemali M., Chapel A., Kieffer-Jaquinod S., Jadot M., Garin J., Journet A. Biochem. J. 402:449-458(2007)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Mouse Putative phospholipase B-like 2(Plbd2)
    Regular price
    £536.00 GBP
    Sale price
    £536.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mouse Putative phospholipase B-like 2(Plbd2)
    Regular price
    £538.00 GBP
    Sale price
    £538.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Rat Putative phospholipase B-like 2(Plbd2)
    Regular price
    £538.00 GBP
    Sale price
    £538.00 GBP
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Rat Putative phospholipase B-like 2(Plbd2)
    Regular price
    £538.00 GBP
    Sale price
    £538.00 GBP
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share