Recombinant Mouse Myoglobin(Mb)

Recombinant Mouse Myoglobin(Mb)

CSB-YP013529MO
Regular price
£538.00 GBP
Sale price
£538.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: Cardiovascular

Target / Protein: Mb

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Mus musculus (Mouse)

Delivery time: 3-7 business days

Uniprot ID: P04247

AA Sequence: GLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG

Tag info: N-terminal 6xHis-tagged and C-terminal Myc-tagged

Expression Region: 2-154aa

Protein length: Full Length

MW: 18.9 kDa

Alternative Name(s):

Relevance: Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles.

Reference: "The mouse myoglobin gene. Characterisation and sequence comparison with other mammalian myoglobin genes." Blanchetot A., Price M., Jeffreys A.J. Eur. J. Biochem. 159:469-474(1986)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share