
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Immunology
Uniprot ID: Q64253
Gene Names: Ly6e
Organism: Mus musculus (Mouse)
AA Sequence: LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA
Expression Region: 21-102aa
Sequence Info: Full Length of Mature Protein
Source: E.coli
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW: 13.8 kDa
Alternative Name(s): Stem cell antigen 2 Thymic shared antigen 1
Relevance: Involved in T-cell development.
Reference: "Genomic organization and expression of mouse thymic shared antigen-1 (TSA-1): evidence for a processed pseudogene." Classon B.J., Coverdale L. Immunogenetics 44:222-226(1996)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Mouse Lymphocyte antigen 6E(Ly6e)
- Regular price
- £541.00 GBP
- Sale price
- £541.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Lymphocyte antigen 6E(Ly6e)
- Regular price
- £539.00 GBP
- Sale price
- £539.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Lymphocyte antigen 6E(Ly6e)
- Regular price
- £539.00 GBP
- Sale price
- £539.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Lymphocyte antigen 6E(Ly6e)
- Regular price
- £541.00 GBP
- Sale price
- £541.00 GBP
- Regular price
-
- Unit price
- per
Sold out