
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170725
Research areas: others
Target / Protein: Ly6c1
Biologically active: Not Tested
Expression system: Yeast
Species of origin: Mus musculus (Mouse)
Delivery time: 3-7 business days
Uniprot ID: P0CW02
AA Sequence: LQCYECYGVPIETSCPAVTCRASDGFCIAQNIELIEDSQRRKLKTRQCLSFCPAGVPIRDPNIRERTSCCSEDLCNAAVPTAG
Tag info: N-terminal 6xHis-SUMOSTAR-tagged
Expression Region: 27-109aa
Protein length: Full Length of Mature Protein
MW: 25.1 kDa
Alternative Name(s):
Relevance:
Reference: "B cells express Ly-6C in a Th1 but not Th2 cytokine environment." Schlueter A.J., Krieg A.M., De Vries P., Li X. J. Interferon Cytokine Res. 22:799-806(2002)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Mouse Lymphocyte antigen 6C1(Ly6c1)
- Regular price
- £480.00 GBP
- Sale price
- £480.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Lymphocyte antigen 6C1(Ly6c1)
- Regular price
- £616.00 GBP
- Sale price
- £616.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Lymphocyte antigen 6E(Ly6e)
- Regular price
- £543.00 GBP
- Sale price
- £543.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Lymphocyte antigen 6E(Ly6e)
- Regular price
- £541.00 GBP
- Sale price
- £541.00 GBP
- Regular price
-
- Unit price
- per
Sold out