Recombinant Mouse Excitatory amino acid transporter 2(Slc1a2),partial

Recombinant Mouse Excitatory amino acid transporter 2(Slc1a2),partial

CSB-YP021433MO
Regular price
£536.00 GBP
Sale price
£536.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P43006

Gene Names: Slc1a2

Organism: Mus musculus (Mouse)

AA Sequence: HPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPSEEANTTKAVISMLNETMNEAPEETKIVIKKGLEFKDG

Expression Region: 143-238aa

Sequence Info: Extracellular Domain

Source: Yeast

Tag Info: N-terminal GST-tagged

MW: 37.6 kDa

Alternative Name(s): GLT-1Sodium-dependent glutamate/aspartate transporter 2Solute carrier family 1 member 2

Relevance: Transports L-glutamate and also L- and D-aspartate. Essential for terminating the postsynaptic action of glutamate by rapidly roving released glutamate from the synaptic cleft. Acts as a symport by cotransporting sodium.

Reference: Large-scale identification and evolution indexing of tyrosine phosphorylation sites from murine brain.Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P.J. Proteome Res. 7:311-318(2008)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share