Recombinant Methanosarcina barkeri  Tetrahydromethanopterin S-methyltransferase subunit B(mtrB)

Recombinant Methanosarcina barkeri Tetrahydromethanopterin S-methyltransferase subunit B(mtrB)

CSB-CF896978MSM
Regular price
£862.00 GBP
Sale price
£862.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Methanosarcina barkeri (strain Fusaro / DSM 804)

Uniprot NO.:Q9Y8K3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSMIRIAPELNLVMDPETGTITQERKDSIQYSMEPVFERVDKLDAIADDLVNSLSPSNPL LNSWPGRENTSYMAGFYGNTFYGVIIGLAFSGLLALVIYIASLMRGVV

Protein Names:Recommended name: Tetrahydromethanopterin S-methyltransferase subunit B EC= 2.1.1.86 Alternative name(s): N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit B

Gene Names:Name:mtrB Ordered Locus Names:Mbar_A1259

Expression Region:1-108

Sequence Info:full length protein

Your list is ready to share