Recombinant Methanocaldococcus jannaschii  Uncharacterized protein MJ1155.1 (MJ1155.1)

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1155.1 (MJ1155.1)

CSB-CF305866MRU
Regular price
£867.00 GBP
Sale price
£867.00 GBP
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Uniprot NO.:P81316

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDKNILAIIFVAVGTYLIRYIPIHLHSKIKNIDEKVKEINEILIYSSTSVISALFITSFI KFPIIFSNVLISTISLIFAIVSYKKWNNLGISILISVVIYYLASKFLISI

Protein Names:Recommended name: Uncharacterized protein MJ1155.1

Gene Names:Ordered Locus Names:MJ1155.1

Expression Region:1-110

Sequence Info:full length protein

Your list is ready to share