
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Latimeria chalumnae (West Indian ocean coelacanth)
Uniprot NO.:O03170
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAHQAHAYHMVDPSPWPITGATAALLVTSGLAAWFHFNSMILILMGLTLLLLTMYQWWRD IIRESTFQGHHTLPVQKSLRYGMILFITSEVFFFLGFFWAFYHSSLAPTPELGGLWPPTG ITPLDPFEVPLLNTAVLLASGITVTWAHHSLMEGQRKEAIQSLFITVLLGLYFTALQATE YYESPFTIADGAYGSTFFVATGFHGLHVIIGSTFLIVCLVRQTQYHFTSNHHFGFEAAAW YWHFVDVVWLFLYVSIYWWGS
Protein Names:Recommended name: Cytochrome c oxidase subunit 3 EC= 1.9.3.1 Alternative name(s): Cytochrome c oxidase polypeptide III
Gene Names:Name:MT-CO3 Synonyms:COIII, COXIII, MTCO3
Expression Region:1-261
Sequence Info:full length protein
You may also like
-
Recombinant Latimeria chalumnae Cytochrome c oxidase subunit 2(MT-CO2)
- Regular price
- £937.00 GBP
- Sale price
- £937.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Litocranius walleri Cytochrome c oxidase subunit 3(MT-CO3)
- Regular price
- £955.00 GBP
- Sale price
- £955.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Lemur catta Cytochrome c oxidase subunit 3(MT-CO3)
- Regular price
- £964.00 GBP
- Sale price
- £964.00 GBP
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Cytochrome c oxidase subunit 3(MT-CO3)
- Regular price
- £952.00 GBP
- Sale price
- £952.00 GBP
- Regular price
-
- Unit price
- per
Sold out